RetrogeneDB ID: | retro_cpor_1315 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_7:8897404..8897672(+) | ||
| Located in intron of: | ENSCPOG00000006720 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NPM3 | ||
| Ensembl ID: | ENSCPOG00000006301 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.58 % |
| Parental protein coverage: | 56.79 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | EDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQ-PMLSLDD-FQLQPP-VTFR |
| .D.AEH.LALTMLCLT.GAK..CNVV...A.NHDHQEI...VA.LKLSC..PMLSLDD.FQLQPP.V.FR | |
| Retrocopy | DDNAEHLLALTMLCLTKGAKNKCNVV---AWNHDHQEISGLVASLKLSCH<PMLSLDDCFQLQPP<VIFR |
| Parental | LKSGSGPVRVTGRHQIVTISNDVAE |
| LK.GSG..R.TGRH..VTIS.DV.E | |
| Retrocopy | LKWGSGRLRITGRHHVVTISKDVSE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 2 .13 RPM | 4 .14 RPM |
| SRP017611_kidney | 0 .73 RPM | 9 .74 RPM |
| SRP017611_liver | 0 .17 RPM | 6 .22 RPM |
| SRP040447_lung | 0 .63 RPM | 10 .49 RPM |
| SRP040447_skeletal_muscle | 0 .16 RPM | 9 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017639 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000016335 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000009919 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017650 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000006301 | 1 retrocopy |
retro_cpor_1315 ,
|
| Dasypus novemcinctus | ENSDNOG00000018876 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003491 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007178 | 1 retrocopy | |
| Homo sapiens | ENSG00000107833 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003465 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011739 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004961 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015774 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016894 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000056209 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009229 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002589 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002875 | 1 retrocopy |