RetrogeneDB ID: | retro_fcat_1906 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | X:39420175..39420489(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSFCAG00000007178 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 62.26 % |
Parental protein coverage: | 56.82 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | AAGAAAALAFLSQESRV--RAG-GVGGLRVPAPVTMDSFFLG---CELSGHTRSFTFKVEEEDESEHVLA |
AAG.A.ALAF..QESR...RAG...GG..V..PVTMDSF......C..S...RSFTFKVEEED....VLA | |
Retrocopy | AAGVATALAFWNQESRAHARAG<VEGGGQVWPPVTMDSFSFS*VDCQQSSQIRSFTFKVEEEDDVGPVLA |
Parental | LTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANL |
LT.LCL..GAK..CNV.EV.A.N.D.QE.AVPVANL | |
Retrocopy | LTTLCLIKGAKGQCNVLEVMAGNQDRQETAVPVANL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 6 .66 RPM |
SRP017611_kidney | 0 .00 RPM | 10 .51 RPM |
SRP017611_liver | 0 .00 RPM | 9 .81 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017639 | 2 retrocopies | |
Bos taurus | ENSBTAG00000016335 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000009919 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000017650 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000006301 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000018876 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000003491 | 1 retrocopy | |
Felis catus | ENSFCAG00000007178 | 1 retrocopy |
retro_fcat_1906 ,
|
Felis catus | ENSFCAG00000030268 | 3 retrocopies | |
Homo sapiens | ENSG00000107833 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000003465 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000011739 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004961 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015774 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016894 | 2 retrocopies | |
Mus musculus | ENSMUSG00000056209 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009229 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002589 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000002875 | 1 retrocopy |