RetrogeneDB ID: | retro_mmul_1072 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 14:71570263..71570585(+) | ||
| Located in intron of: | ENSMMUG00000003142 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.18955 | ||
| Ensembl ID: | ENSMMUG00000015774 | ||
| Aliases: | None | ||
| Description: | nucleoplasmin-3 [Source:RefSeq peptide;Acc:NP_001181431] |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 60.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | AAALAFLSQESRTRAG-GVGGLRVSAPVTMDSFFFGCE-LSGHTRSFTFKVEEEDDAEHVLALTMLCLTE |
| A.....LSQE.....G.GVG.L...A.VTMDSFFF.C..LSGHT.SFTFKVE.ED...HVLAL.MLC.T. | |
| Retrocopy | ASTATTLSQENQAQTG<GVGSLGIPASVTMDSFFFVCS<LSGHTHSFTFKVEKEDNMKHVLALIMLCFTK |
| Parental | GAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDD |
| GA..E.NVVEVV..N.DHQEI.V.VANLKLSCQP.....D | |
| Retrocopy | GANNE*NVVEVVTWNYDHQEITVSVANLKLSCQPVTIRND |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 4 .93 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .63 RPM |
| SRP007412_cerebellum | 0 .26 RPM | 1 .42 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .22 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .73 RPM |
| SRP007412_testis | 0 .04 RPM | 6 .75 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_792 |
| Pan troglodytes | retro_ptro_551 |
| Pongo abelii | retro_pabe_706 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017639 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000016335 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000009919 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017650 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000006301 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018876 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003491 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007178 | 1 retrocopy | |
| Homo sapiens | ENSG00000107833 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003465 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011739 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004961 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015774 | 1 retrocopy |
retro_mmul_1072 ,
|
| Macaca mulatta | ENSMMUG00000015781 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016894 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000056209 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009229 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002589 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002875 | 1 retrocopy |