RetrogeneDB ID: | retro_cpor_444 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_158:862397..862735(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMA16 | ||
Ensembl ID: | ENSCPOG00000001119 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.42 % |
Parental protein coverage: | 56.28 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LIHPYSRKAAQIARHAHKLEKKERLKH-EKALRLNLISEKLQWFQNELDPQK-VRYSRKDACQLVERYLN |
..H.YSRKAAQI.R.AHK.E.KE.....EK...LNLI..KLQWFQN.L.PQK..RYS.KDACQL.ERYLN | |
Retrocopy | ILHLYSRKAAQIMREAHKQENKEN*RM>EKTIHLNLIGKKLQWFQNKLEPQK>LRYSKKDACQLTERYLN |
Parental | RFSSELEQIELLNSIKDRQGRRHHSREMFIKQTIERERQQYEGY |
.FSSELE.IEL.NSIKDRQGR..H..E..IK.T.ERE.QQY.GY | |
Retrocopy | GFSSELEWIELHNSIKDRQGRQYHPWETIIKHTMEREQQQYQGY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 5 .58 RPM |
SRP017611_kidney | 0 .00 RPM | 6 .28 RPM |
SRP017611_liver | 0 .00 RPM | 5 .44 RPM |
SRP040447_lung | 0 .00 RPM | 5 .85 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 4 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006702 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000001119 | 1 retrocopy |
retro_cpor_444 ,
|
Dasypus novemcinctus | ENSDNOG00000006820 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000009734 | 1 retrocopy | |
Homo sapiens | ENSG00000198498 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025324 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001134 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000004482 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000002170 | 1 retrocopy | |
Mus musculus | ENSMUSG00000025591 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006466 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000001860 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015167 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000023618 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000014188 | 3 retrocopies | |
Sorex araneus | ENSSARG00000003780 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000024763 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000017224 | 7 retrocopies | |
Tarsius syrichta | ENSTSYG00000008284 | 1 retrocopy |