RetrogeneDB ID: | retro_cpor_607 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_2:41229649..41229832(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM5 | ||
| Ensembl ID: | ENSCPOG00000010421 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 59.02 % |
| Parental protein coverage: | 67.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQ |
| QL..LE..D.CI.SR.HIVM.S.K.IV...LGFD.FV..VLEDVT..EI.PEGR.....D. | |
| Retrocopy | QLWLLEVADRCIESRTHIVMSSKKKIVCITLGFDAFVSLVLEDVTKVEILPEGRSRPDFDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .66 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .92 RPM |
| SRP040447_lung | 0 .00 RPM | 5 .75 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 5 .30 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006700 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000010421 | 1 retrocopy |
retro_cpor_607 ,
|
| Equus caballus | ENSECAG00000018445 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
| Mus musculus | ENSMUSG00000091625 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000015268 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013892 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000019057 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000009786 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000004876 | 11 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004237 | 3 retrocopies |