RetrogeneDB ID: | retro_mmus_837 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 11:121092385..121092574(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000083137 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Lsm5 | ||
Ensembl ID: | ENSMUSG00000091625 | ||
Aliases: | Lsm5, 2010208O10Rik, 2310034K10Rik | ||
Description: | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1913623] |
Percent Identity: | 81.54 % |
Parental protein coverage: | 71.43 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGN |
L....VDKCIGSR.HIVMKSDKEIVGT.LGFDDFVNMVLEDVT.FEITPE..RITKLDQIL..G. | |
Retrocopy | LQIRVVDKCIGSRVHIVMKSDKEIVGTFLGFDDFVNMVLEDVTDFEITPE--RITKLDQILNGGS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 1 .59 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .69 RPM |
SRP007412_heart | 0 .00 RPM | 1 .28 RPM |
SRP007412_kidney | 0 .00 RPM | 1 .23 RPM |
SRP007412_liver | 0 .03 RPM | 1 .37 RPM |
SRP007412_testis | 0 .00 RPM | 1 .23 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006700 | 1 retrocopy | |
Bos taurus | ENSBTAG00000002332 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000010421 | 1 retrocopy | |
Equus caballus | ENSECAG00000018445 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
Loxodonta africana | ENSLAFG00000029579 | 3 retrocopies | |
Mus musculus | ENSMUSG00000091625 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000015268 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013892 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019057 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000009786 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000004876 | 11 retrocopies | |
Tursiops truncatus | ENSTTRG00000004237 | 3 retrocopies |