RetrogeneDB ID: | retro_dnov_1057 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_141653:1182..1362(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LAMTOR3 | ||
Ensembl ID: | ENSDNOG00000025421 | ||
Aliases: | None | ||
Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606] |
Percent Identity: | 73.33 % |
Parental protein coverage: | 67.42 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | ANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQXXQFNRLPLVVSSIAS |
AND.APE.A.RP.FLSTFALATDQ.SKLGLSKNKS.IC..NT....QFN.LPL.VS.I.S | |
Retrocopy | ANDKAPEPASRPSFLSTFALATDQESKLGLSKNKSAICDFNT*RVVQFNHLPLLVSFITS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 1 .17 RPM |
SRP012922_cerebellum | 0 .00 RPM | 0 .96 RPM |
SRP012922_heart | 0 .00 RPM | 0 .46 RPM |
SRP012922_kidney | 0 .00 RPM | 1 .10 RPM |
SRP012922_liver | 0 .00 RPM | 0 .31 RPM |
SRP012922_lung | 0 .00 RPM | 1 .07 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 0 .35 RPM |
SRP012922_spleen | 0 .00 RPM | 1 .37 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000995 | 4 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000013153 | 7 retrocopies | |
Callithrix jacchus | ENSCJAG00000015196 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000013304 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000025421 | 14 retrocopies | |
Dipodomys ordii | ENSDORG00000015501 | 5 retrocopies | |
Equus caballus | ENSECAG00000013569 | 1 retrocopy | |
Homo sapiens | ENSG00000109270 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001132 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000015740 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000006786 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000006830 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000020688 | 3 retrocopies | |
Mus musculus | ENSMUSG00000091512 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013684 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014955 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000016310 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000017674 | 1 retrocopy |