RetrogeneDB ID: | retro_dnov_1452 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_20686:16970..17189(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | YWHAE | ||
Ensembl ID: | ENSDNOG00000003808 | ||
Aliases: | None | ||
Description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide [Source:HGNC Symbol;Acc:12851] |
Percent Identity: | 90.41 % |
Parental protein coverage: | 55.73 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | EILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDXXXQNKEALQDVED |
EILNSPD.ACRLAKAAFDDAIAELDTLSEESYKDSTLIM.L.RDNLTLWTSDMQGD...QNKE.LQDVED | |
Retrocopy | EILNSPDHACRLAKAAFDDAIAELDTLSEESYKDSTLIM*LFRDNLTLWTSDMQGDGEEQNKEVLQDVED |
Parental | ENQ |
ENQ | |
Retrocopy | ENQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 1 .17 RPM | 84 .98 RPM |
SRP012922_cerebellum | 2 .20 RPM | 119 .87 RPM |
SRP012922_heart | 1 .16 RPM | 57 .08 RPM |
SRP012922_kidney | 2 .19 RPM | 72 .28 RPM |
SRP012922_liver | 0 .46 RPM | 35 .30 RPM |
SRP012922_lung | 0 .31 RPM | 62 .01 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 81 .87 RPM |
SRP012922_spleen | 0 .34 RPM | 49 .68 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000010861 | 2 retrocopies | |
Ciona intestinalis | ENSCING00000023856 | 1 retrocopy | |
Ciona savignyi | ENSCSAVG00000011723 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000001672 | 10 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000003808 | 2 retrocopies |
retro_dnov_1452 , retro_dnov_2602,
|
Echinops telfairi | ENSETEG00000012056 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000016840 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000014607 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007769 | 4 retrocopies |