RetrogeneDB ID: | retro_dnov_1496 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_21889:129..468(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000024987 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.26 % |
Parental protein coverage: | 64.37 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MCAAEADRWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQEAQMRAEIQGMKQELSTVNMMDEFA |
...A.A..WAWLL.LSF.F.C.VLR..L....SFMSR.LQK..EQEA.MRAEIQGMKQEL.TVNMMDEF. | |
Retrocopy | LSTAKANCWAWLLILSFMF*CKVLRPPLVILFSFMSRLLQKHVEQEAHMRAEIQGMKQELTTVNMMDEFV |
Parental | RYARLERKINK-MTDKLKTHVKARTAQLAKIKWVISVAFYVLQ |
RYARLERKIN...TD.LKT...A..AQ..KIK.VISVA.Y..Q | |
Retrocopy | RYARLERKINRWITDNLKTQMNAWMAQISKIK*VISVALYASQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 4 .08 RPM |
SRP012922_cerebellum | 0 .55 RPM | 12 .65 RPM |
SRP012922_heart | 0 .00 RPM | 5 .34 RPM |
SRP012922_kidney | 0 .00 RPM | 4 .93 RPM |
SRP012922_liver | 0 .00 RPM | 4 .80 RPM |
SRP012922_lung | 0 .00 RPM | 10 .84 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 5 .02 RPM |
SRP012922_spleen | 0 .00 RPM | 7 .67 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000005714 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000024987 | 1 retrocopy |
retro_dnov_1496 ,
|
Homo sapiens | ENSG00000182093 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013144 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000015808 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020654 | 2 retrocopies | |
Mus musculus | ENSMUSG00000023147 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013146 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000026761 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000011427 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013915 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000012736 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015373 | 1 retrocopy |