RetrogeneDB ID: | retro_ptro_2078 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 4:115332402..115332726(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | WRB | ||
Ensembl ID: | ENSPTRG00000013915 | ||
Aliases: | None | ||
Description: | Pan troglodytes tryptophan rich basic protein (WRB), mRNA. [Source:RefSeq mRNA;Acc:NM_001251919] |
Percent Identity: | 77.98 % |
Parental protein coverage: | 62.64 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFA |
...A.A.HWAWLLVL.F.FGC.VL.ILLPSFS.FMSRV..KDAEQESQ..AEIQDMKQELS.VNMMD.FA | |
Retrocopy | VGTAKANHWAWLLVLRFLFGCSVLQILLPSFS-FMSRVQRKDAEQESQIKAEIQDMKQELSAVNMMDKFA |
Parental | RYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFY |
R.ARLERKINKMT.KLKTHVK..TAQ....KWVISVAFY | |
Retrocopy | RSARLERKINKMTNKLKTHVKVQTAQSGMLKWVISVAFY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 44 .20 RPM |
SRP007412_cerebellum | 0 .00 RPM | 41 .44 RPM |
SRP007412_heart | 0 .12 RPM | 19 .62 RPM |
SRP007412_kidney | 0 .03 RPM | 26 .75 RPM |
SRP007412_liver | 0 .00 RPM | 14 .34 RPM |
SRP007412_testis | 0 .00 RPM | 43 .63 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3080 |
Pongo abelii | retro_pabe_2552 |
Macaca mulatta | retro_mmul_1966 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000005714 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000024987 | 1 retrocopy | |
Homo sapiens | ENSG00000182093 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013144 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000015808 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020654 | 2 retrocopies | |
Mus musculus | ENSMUSG00000023147 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013146 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000026761 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000011427 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013915 | 1 retrocopy |
retro_ptro_2078 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000012736 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015373 | 1 retrocopy |