RetrogeneDB ID: | retro_dnov_1577 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_2390:90427..90643(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000005868 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 54.17 % |
Parental protein coverage: | 74.23 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | WSTPPAASAAAMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRG |
.S....AS....GV.V..ISP.DG..F.K..QTC.VHY..MLEDGK.F.SS..R...FKF..GK.EVI.G | |
Retrocopy | YSSASPASTTTLGV*VKNISPQDGHIFLKQSQTCLVHYMLMLEDGKRFLSSWQRKTSFKFRIGK*EVIPG |
Parental | WE |
.E | |
Retrocopy | *E |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 31 .89 RPM |
SRP012922_cerebellum | 0 .00 RPM | 14 .57 RPM |
SRP012922_heart | 0 .00 RPM | 10 .67 RPM |
SRP012922_kidney | 0 .00 RPM | 12 .32 RPM |
SRP012922_liver | 0 .00 RPM | 11 .15 RPM |
SRP012922_lung | 0 .00 RPM | 27 .49 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 10 .56 RPM |
SRP012922_spleen | 0 .00 RPM | 38 .92 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004678 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000005868 | 16 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000011244 | 1 retrocopy | |
Homo sapiens | ENSG00000088832 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
Mus musculus | ENSMUSG00000032966 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000008816 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000008822 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |