RetrogeneDB ID: | retro_dnov_2404 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_7179:629..829(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSDNOG00000016240 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000005868 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.71 % |
| Parental protein coverage: | 69.07 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SAAAMGVQVETISPGDGRTFPKRGQTCV-VHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEG |
| S.A.MGVQVETI..G.G.TF.K..QTC..V.Y...LED.KKFDSS.DRN.PFKF.LGKQEVI.....G | |
| Retrocopy | SSATMGVQVETIFIGNGCTFLKHCQTCM<VDYARILEDRKKFDSSQDRNNPFKFMLGKQEVIQVGRRG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 31 .89 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 14 .57 RPM |
| SRP012922_heart | 0 .00 RPM | 10 .67 RPM |
| SRP012922_kidney | 0 .00 RPM | 12 .32 RPM |
| SRP012922_liver | 0 .00 RPM | 11 .15 RPM |
| SRP012922_lung | 0 .00 RPM | 27 .49 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 10 .56 RPM |
| SRP012922_spleen | 0 .00 RPM | 38 .92 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004678 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000005868 | 16 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000011244 | 1 retrocopy | |
| Homo sapiens | ENSG00000088832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000032966 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000008816 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008822 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |