RetrogeneDB ID: | retro_dnov_173 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_2331:58497..58899(+) | ||
Located in intron of: | ENSDNOG00000024063 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS15 | ||
Ensembl ID: | ENSDNOG00000000706 | ||
Aliases: | None | ||
Description: | ribosomal protein S15 [Source:HGNC Symbol;Acc:10388] |
Percent Identity: | 59.12 % |
Parental protein coverage: | 97.12 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | EVEQKKKRTFRKFTYR-GVDLDQLLD-MSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPM |
EVEQK...T..KF.Y...V...QL.D.MSYE.LMQL.S..Q.R.L...L..K.H..LK.L.KA.KEAPPM | |
Retrocopy | EVEQKQQHTSLKFIYL<SVEFNQLQD>MSYEHLMQLRST*QQRYLKCDLWWKHH*MLKWLGKATKEAPPM |
Parental | EKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATH |
EKPEVVK.HL.D.I.LPEM.GSMVG.YNGKT.NQVE.K..MIGHYLG..SI........RP.....H | |
Retrocopy | EKPEVVKMHLHD-ITLPEMAGSMVGIYNGKTINQVETKSKMIGHYLGKLSIYHLQACEARPAQHWSH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 619 .77 RPM |
SRP012922_cerebellum | 0 .14 RPM | 286 .90 RPM |
SRP012922_heart | 0 .00 RPM | 297 .23 RPM |
SRP012922_kidney | 0 .00 RPM | 738 .15 RPM |
SRP012922_liver | 0 .15 RPM | 357 .76 RPM |
SRP012922_lung | 0 .00 RPM | 639 .76 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 560 .62 RPM |
SRP012922_spleen | 0 .00 RPM | 870 .02 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000005632 | 13 retrocopies | |
Cavia porcellus | ENSCPOG00000003968 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000706 | 2 retrocopies |
retro_dnov_173 , retro_dnov_85,
|
Echinops telfairi | ENSETEG00000008645 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002818 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000005119 | 1 retrocopy | |
Mus musculus | ENSMUSG00000063457 | 8 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001651 | 8 retrocopies | |
Otolemur garnettii | ENSOGAG00000015776 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000009317 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000010200 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000024603 | 8 retrocopies | |
Sus scrofa | ENSSSCG00000023248 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006423 | 2 retrocopies |