RetrogeneDB ID: | retro_cpor_495 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_17:32958305..32958691(+) | ||
| Located in intron of: | ENSCPOG00000010071 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000003968 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.15 % |
| Parental protein coverage: | 88.97 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 5 |
| Parental | EVEQKKKRTFRKFT-YRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKE-APPM |
| EVEQKKK.TFRKFT..R.VDLDQLLDMS.E.LMQLY.......LNRG...KQHSLLKRL.K.KKE.APP. | |
| Retrocopy | EVEQKKK*TFRKFT>NRVVDLDQLLDMSHELLMQLYRVWKWQQLNRGCQQKQHSLLKRLCKVKKE>APPL |
| Parental | EKPEVVKTHLR-DMIILPEMVGSMV-GVYNGKTFNQVEIKPEMI-GHYLGEFSITYKPVKHGRP |
| E.PEVVKTHL...M..LPE.VGSMV.GV..GKTF.QVE.KPEM..GHYLG..SITY.P.K.G.P | |
| Retrocopy | EQPEVVKTHLQ<GMVLLPEVVGSMV<GVCSGKTFSQVEMKPEMM<GHYLGVLSITYNPGKLGQP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 67 .87 RPM |
| SRP017611_kidney | 0 .00 RPM | 121 .96 RPM |
| SRP017611_liver | 0 .00 RPM | 68 .12 RPM |
| SRP040447_lung | 0 .03 RPM | 197 .73 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 189 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019718 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005632 | 13 retrocopies | |
| Cavia porcellus | ENSCPOG00000003968 | 1 retrocopy |
retro_cpor_495 ,
|
| Dasypus novemcinctus | ENSDNOG00000000706 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000008645 | 1 retrocopy | |
| Felis catus | ENSFCAG00000010769 | 1 retrocopy | |
| Homo sapiens | ENSG00000115268 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002818 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000005119 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063457 | 8 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001651 | 8 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015776 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000009317 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000010200 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003168 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000024603 | 8 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000013424 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023248 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006423 | 2 retrocopies |