RetrogeneDB ID: | retro_dnov_835 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_112730:57..502(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSMD10 | ||
| Ensembl ID: | ENSDNOG00000001902 | ||
| Aliases: | None | ||
| Description: | proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 [Source:HGNC Symbol;Acc:9555] |
| Percent Identity: | 80.54 % |
| Parental protein coverage: | 66.07 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVN |
| SL.TR.DQDSRTALHWACSAGH.E.VEF...LGV.VNDK.D.GWSPLH.AASAGRDEIVK.LLGKGAQVN | |
| Retrocopy | SLLTRIDQDSRTALHWACSAGHSENVEFCIRLGVRVNDKVDVGWSPLHVAASAGRDEIVKVLLGKGAQVN |
| Parental | A-VNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHFEATAMHRAAAKGNLKMIHILLYYKASTNIQD |
| ..VNQ.G..PL..A.SKNRHEIAVMLLEGGANP.AKDH.EATAMHRAAAKGNLKM..ILLYYKASTNIQ. | |
| Retrocopy | C>VNQSGSSPLYCASSKNRHEIAVMLLEGGANPYAKDHLEATAMHRAAAKGNLKMFNILLYYKASTNIQY |
| Parental | TEGNTPLHL |
| .E.NT.L.L | |
| Retrocopy | RESNTTLSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 10 .11 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 20 .90 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .94 RPM |
| SRP012922_kidney | 0 .00 RPM | 13 .69 RPM |
| SRP012922_liver | 0 .00 RPM | 3 .72 RPM |
| SRP012922_lung | 0 .00 RPM | 11 .00 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 4 .33 RPM |
| SRP012922_spleen | 0 .00 RPM | 9 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000012006 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007717 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015068 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001902 | 5 retrocopies | |
| Homo sapiens | ENSG00000101843 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002969 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000002059 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000014534 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016981 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014001 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010837 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006419 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005221 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020618 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000022169 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003783 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009920 | 13 retrocopies |