RetrogeneDB ID: | retro_ptro_831 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 13:72914769..72915212(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSMD10 | ||
| Ensembl ID: | ENSPTRG00000022169 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 88.59 % |
| Parental protein coverage: | 65.49 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD |
| MEGCVSNLMVCNLAYS.KLEE.KE.ILADKSLATRTDQDSRTALH.ACSAGH..I.EFLLQLGVPVNDKD | |
| Retrocopy | MEGCVSNLMVCNLAYSRKLEEFKEGILADKSLATRTDQDSRTALH*ACSAGHKGIDEFLLQLGVPVNDKD |
| Parental | DAGWSPL-HIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYE |
| DA.WSPL..IAASAG.DEIVKALLGKGAQVNAV.QN.CTPLHYAASKNRHEIAVMLLEG.ANP.AKDHYE | |
| Retrocopy | DASWSPL<QIAASAGWDEIVKALLGKGAQVNAVHQNDCTPLHYAASKNRHEIAVMLLEGRANPHAKDHYE |
| Parental | ATAMHRAAA |
| ATA.H.AAA | |
| Retrocopy | ATALH*AAA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 21 .68 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 29 .54 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .14 RPM |
| SRP007412_kidney | 0 .03 RPM | 20 .48 RPM |
| SRP007412_liver | 0 .07 RPM | 15 .02 RPM |
| SRP007412_testis | 0 .00 RPM | 21 .81 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1214 |
| Gorilla gorilla | retro_ggor_945 |
| Pongo abelii | retro_pabe_1010 |
| Macaca mulatta | retro_mmul_1290 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000012006 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007717 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015068 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001902 | 5 retrocopies | |
| Homo sapiens | ENSG00000101843 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002969 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000016981 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014001 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010837 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006419 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005221 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020618 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000022169 | 3 retrocopies |
retro_ptro_1407, retro_ptro_1851, retro_ptro_831 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000003783 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009920 | 13 retrocopies |