RetrogeneDB ID: | retro_dord_549 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
Coordinates: | scaffold_30429:12073..12290(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rps27a | ||
Ensembl ID: | ENSDORG00000006291 | ||
Aliases: | None | ||
Description: | ribosomal protein S27A [Source:MGI Symbol;Acc:MGI:1925544] |
Percent Identity: | 57.53 % |
Parental protein coverage: | 67.29 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | IENVKAKIQDKEG-IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKN |
.EN..AKIQ.KE..I.P.QQR.IFAGKQLEDG.TLSD.NIQ.E.TL..VLRL...AKK............ | |
Retrocopy | LENTEAKIQYKEK>IHPHQQR*IFAGKQLEDG*TLSD*NIQ*EFTLYFVLRLHDNAKKGRSPKKNNHNRK |
Parental | KHK |
K.K | |
Retrocopy | KVK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |