RetrogeneDB ID: | retro_eeur_72 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | GeneScaffold_418:107421..107640(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS27A | ||
Ensembl ID: | ENSEEUG00000002329 | ||
Aliases: | None | ||
Description: | ribosomal protein S27a [Source:HGNC Symbol;Acc:10417] |
Percent Identity: | 82.19 % |
Parental protein coverage: | 70.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | IFVKTLTGKTITLEVEPSDTIENVKAKIQDK-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR |
IFVK.LT.KTITLE.E.SD.IENVKAKIQDK.GI..DQQRLIFAGKQLEDGRTLSDYNIQK..TLHLV.. | |
Retrocopy | IFVKILTDKTITLEMELSDSIENVKAKIQDKEGILSDQQRLIFAGKQLEDGRTLSDYNIQKKLTLHLVFH |
Parental | LRG |
L.G | |
Retrocopy | LKG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 59 .46 RPM |
SRP017611_kidney | 0 .19 RPM | 112 .71 RPM |
SRP017611_liver | 0 .00 RPM | 82 .64 RPM |