RetrogeneDB ID: | retro_ecab_164 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 1:60841166..60841589(-) | ||
Located in intron of: | ENSECAG00000012496 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENOPH1 | ||
Ensembl ID: | ENSECAG00000019612 | ||
Aliases: | None | ||
Description: | enolase-phosphatase 1 [Source:HGNC Symbol;Acc:24599] |
Percent Identity: | 75.89 % |
Parental protein coverage: | 54.23 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | LDRKTTALKQLQGHMWRAAFTAGRMKAEFFEDVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDI |
LD.KT..LK.LQG.MWRA.FT.G.MKA.FFEDVV.AVRKWREAGMKVYIYSSG..EAQKLL.GHS.E.DI | |
Retrocopy | LD*KTMVLKHLQGYMWRAVFTGGSMKAAFFEDVVLAVRKWREAGMKVYIYSSGNGEAQKLLSGHSSEEDI |
Parental | LELFDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTLEASAAEEADVHVAVVVRPGNAGLTDDE |
LEL....FDTKIGHKVES.SY.KIA.S.G.S.N.ILFLTDV.L.ASAAEEAD.HVAVVV..G..GLTDD. | |
Retrocopy | LELVHSYFDTKIGHKVESKSY*KIAGSTGYSVNSILFLTDVSLKASAAEEADIHVAVVVTHGSVGLTDDG |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .30 RPM | 14 .93 RPM |
SRP021940_cerebellum | 0 .05 RPM | 37 .34 RPM |
SRP021940_embryo | 0 .41 RPM | 41 .30 RPM |
SRP021940_placental_villous | 0 .10 RPM | 34 .54 RPM |
SRP021940_synovial_membrane | 0 .16 RPM | 32 .64 RPM |
SRP021940_testis | 0 .06 RPM | 36 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005140 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000003283 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000015251 | 2 retrocopies | |
Equus caballus | ENSECAG00000019612 | 1 retrocopy |
retro_ecab_164 ,
|
Erinaceus europaeus | ENSEEUG00000004274 | 1 retrocopy | |
Homo sapiens | ENSG00000145293 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000003719 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000008619 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000011458 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000014460 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000002502 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014887 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016218 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000013987 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000001800 | 1 retrocopy |