RetrogeneDB ID: | retro_ecab_250 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 11:4452120..4452507(+) | ||
Located in intron of: | ENSECAG00000012486 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2V1 | ||
Ensembl ID: | ENSECAG00000011858 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2 variant 1 [Source:HGNC Symbol;Acc:12494] |
Percent Identity: | 55.22 % |
Parental protein coverage: | 86.67 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGM-IIGPPRTIYENR-IYSLKIECGPKYP |
VK...NF..L.ELEEGQ...GD.TVSW.L.DDEDM.LTRWT...IIGPPRT.Y.N..IY.LK.....KYP | |
Retrocopy | VKFTPNFHSLGELEEGQR-LGDSTVSWSL*DDEDMLLTRWTAI<IIGPPRTNYKNK<IYRLKMASESKYP |
Parental | EAPPFVRFVTKINMNGVNS-SNGVVDPRAI-SVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQ |
EAP...RFVTK..MNG....S...VD...I.S...K.......KV....LR.LMMSKE..KL.Q | |
Retrocopy | EAPLSFRFVTKSSMNGISN<SSRMVDIQSIPSSVSKVTKYKTNKVAFSDLRHLMMSKEYTKLLQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 10 .21 RPM |
SRP021940_cerebellum | 0 .00 RPM | 35 .26 RPM |
SRP021940_embryo | 0 .03 RPM | 37 .75 RPM |
SRP021940_placental_villous | 0 .00 RPM | 35 .17 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 19 .99 RPM |
SRP021940_testis | 0 .00 RPM | 56 .46 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000011858 | 3 retrocopies |
retro_ecab_1112, retro_ecab_250 , retro_ecab_900,
|
Homo sapiens | ENSG00000244687 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000012228 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000025894 | 12 retrocopies | |
Pan troglodytes | ENSPTRG00000013615 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000025580 | 21 retrocopies |
retro_rnor_1014, retro_rnor_1032, retro_rnor_1291, retro_rnor_1609, retro_rnor_1649, retro_rnor_1650, retro_rnor_1651, retro_rnor_2055, retro_rnor_2282, retro_rnor_2406, retro_rnor_2407, retro_rnor_2412, retro_rnor_2488, retro_rnor_2489, retro_rnor_2490, retro_rnor_2534, retro_rnor_2535, retro_rnor_2905, retro_rnor_819, retro_rnor_881, retro_rnor_991,
|
Ictidomys tridecemlineatus | ENSSTOG00000014322 | 6 retrocopies |