RetrogeneDB ID: | retro_ecab_292 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 14:8758221..8758640(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUDT21 | ||
Ensembl ID: | ENSECAG00000001043 | ||
Aliases: | None | ||
Description: | nudix (nucleoside diphosphate linked moiety X)-type motif 21 [Source:HGNC Symbol;Acc:13870] |
Percent Identity: | 60.99 % |
Parental protein coverage: | 59.47 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | LPHVLLLQLG-TTFFKLPG----GELNPGEDEVEGLKRLMTEILGRQDGVLQDWVI-DDCIGNWWRPNFE |
.PHV.LLQLG.T.F..L.G....GE....E.E.EG.K.L.T.ILG...GV..DWV..D.C.GN...PN.E | |
Retrocopy | VPHVFLLQLGTTFFKALGGELNPGEDEEEEGEFEGPKLLLTDILGG*SGVPPDWVM<DACTGNQ*GPNLE |
Parental | PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNF |
PPQY.YIPAHITKP.E.KKLF..QLQEKAL...PKNYK..AAPLFEL...APG.GP....LP.LLSRF.F | |
Retrocopy | PPQYAYIPAHITKPPEQKKLFFIQLQEKALSEAPKNYKSTAAPLFELSAQAPGCGPVSFHLPWLLSRFSF |
Parental | I |
. | |
Retrocopy | L |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 38 .90 RPM |
SRP021940_cerebellum | 0 .21 RPM | 19 .89 RPM |
SRP021940_embryo | 0 .49 RPM | 55 .44 RPM |
SRP021940_placental_villous | 0 .05 RPM | 29 .16 RPM |
SRP021940_synovial_membrane | 0 .44 RPM | 27 .75 RPM |
SRP021940_testis | 1 .41 RPM | 161 .33 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016628 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012724 | 3 retrocopies | |
Equus caballus | ENSECAG00000001043 | 1 retrocopy |
retro_ecab_292 ,
|
Erinaceus europaeus | ENSEEUG00000003402 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000028465 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004968 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000003451 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017224 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000009651 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000029848 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000007664 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000003701 | 2 retrocopies |