RetrogeneDB ID: | retro_etel_1451 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_268158:4994..5213(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ERH | ||
Ensembl ID: | ENSETEG00000016172 | ||
Aliases: | None | ||
Description: | enhancer of rudimentary homolog (Drosophila) [Source:HGNC Symbol;Acc:3447] |
Percent Identity: | 63.01 % |
Parental protein coverage: | 70.19 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQP |
.RP.GRTYA..ES.NE.MEGVCKM...HLKRM.P.S.SIT...SQ..D...DLADL.CLVY.A.TQT.QP | |
Retrocopy | QRPGGRTYAASESMNEGMEGVCKM*AGHLKRMKPKSLSITHAASQVLDIMEDLADLRCLVYGAGTQTGQP |
Parental | YNK |
... | |
Retrocopy | HHR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000017798 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000014940 | 2 retrocopies | |
Equus caballus | ENSECAG00000019178 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000007758 | 6 retrocopies | |
Echinops telfairi | ENSETEG00000016172 | 5 retrocopies | |
Homo sapiens | ENSG00000100632 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000011879 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004636 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000086 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000005939 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000002307 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000013963 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000006444 | 1 retrocopy |