RetrogeneDB ID: | retro_pabe_2954 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 6:54506990..54507284(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ERH | ||
| Ensembl ID: | ENSPPYG00000005939 | ||
| Aliases: | None | ||
| Description: | enhancer of rudimentary homolog (Drosophila) [Source:HGNC Symbol;Acc:3447] |
| Percent Identity: | 70.71 % |
| Parental protein coverage: | 95.19 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLV |
| SHTILL.QPTK.PE.RT.ADYESVN.CM.G.CK..EE.LKRM.P..P.......QLFDF.DDLADLSCLV | |
| Retrocopy | SHTILLAQPTKKPEDRT*ADYESVNKCMDGICKINEEYLKRMIPTAP-LSH*YHQLFDFMDDLADLSCLV |
| Parental | YRADTQTYQPYNKDWIKEKIYVLLRRQAQ |
| .RA.TQT.QPYNKD.IKEK.Y.LL..QAQ | |
| Retrocopy | *RANTQTCQPYNKDRIKEKFYMLLSQQAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 40 .75 RPM |
| SRP007412_cerebellum | 0 .61 RPM | 34 .29 RPM |
| SRP007412_heart | 0 .06 RPM | 20 .59 RPM |
| SRP007412_kidney | 0 .07 RPM | 37 .89 RPM |
| SRP007412_liver | 0 .03 RPM | 24 .70 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3594 |
| Pan troglodytes | retro_ptro_2433 |
| Gorilla gorilla | retro_ggor_2424 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017798 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014940 | 2 retrocopies | |
| Equus caballus | ENSECAG00000019178 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007758 | 6 retrocopies | |
| Echinops telfairi | ENSETEG00000016172 | 5 retrocopies | |
| Homo sapiens | ENSG00000100632 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011879 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004636 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000086 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000005939 | 2 retrocopies |
retro_pabe_2954 , retro_pabe_3104,
|
| Sus scrofa | ENSSSCG00000002307 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000013963 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006444 | 1 retrocopy |