RetrogeneDB ID: | retro_sscr_748 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 4:14783033..14783276(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ERH | ||
Ensembl ID: | ENSSSCG00000002307 | ||
Aliases: | None | ||
Description: | Sus scrofa enhancer of rudimentary homolog (Drosophila) (ERH), mRNA. [Source:RefSeq mRNA;Acc:NM_001185163] |
Percent Identity: | 69.14 % |
Parental protein coverage: | 77.88 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | ILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRA |
IL..QP.K.PEGR..AD.E.V.EC.EG..KM.EEHLK.MNPNSPSI...IS.LF.F.DDLAD..CLVY.A | |
Retrocopy | ILRAQPSKGPEGRA*ADHEPVHECREGNYKMEEEHLKKMNPNSPSIARGISPLFAFMDDLADPICLVY*A |
Parental | DTQTYQPYNKD |
DTQT.QPY.KD | |
Retrocopy | DTQTHQPYDKD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 39 .69 RPM |
SRP014902_testis | 0 .00 RPM | 54 .32 RPM |
SRP018288_heart | 0 .00 RPM | 29 .10 RPM |
SRP018288_kidney | 0 .10 RPM | 75 .36 RPM |
SRP018288_liver | 0 .00 RPM | 57 .89 RPM |
SRP018288_lung | 0 .00 RPM | 37 .68 RPM |
SRP018856_adipose | 0 .00 RPM | 51 .91 RPM |
SRP035408_brain | 0 .00 RPM | 142 .83 RPM |
SRP035408_liver | 0 .00 RPM | 129 .75 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000017798 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000014940 | 2 retrocopies | |
Equus caballus | ENSECAG00000019178 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000007758 | 6 retrocopies | |
Echinops telfairi | ENSETEG00000016172 | 5 retrocopies | |
Homo sapiens | ENSG00000100632 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000011879 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004636 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000086 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000005939 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000002307 | 1 retrocopy |
retro_sscr_748 ,
|