RetrogeneDB ID: | retro_etel_783 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_163677:3896..4311(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSETEG00000006101 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.01 % |
Parental protein coverage: | 60.34 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | KLHEIFRGLHEDLQ-GVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKL |
.LHEIF.GLHED...GVP..LLG..GTEEKK.LI..FDEKQQEANE..AEMEEEL.YA.LSF.NPMMSKL | |
Retrocopy | ELHEIFCGLHEDQK<GVPRKLLGKLGTEEKK-LI*NFDEKQQEANEMKAEMEEELLYAHLSFHNPMMSKL |
Parental | RTY-RKDLAKLQREVRSTPLTATAGGRADTKYSAYSVENEHLTRLQSQRALLLQGTDSLNRATQSIERSH |
.TY..KDLAKLQ.EVRS..L.A.AGG.....YS.Y....EHLTRLQS.R.LLL.GTDSL..A.QS.E.S. | |
Retrocopy | *TY<LKDLAKLQQEVRSMSLMAIAGG*GVLEYSTYTIDSEHLTRLQSPRVLLLKGTDSLKQASQSTENSR |
Parental | RI |
RI | |
Retrocopy | RI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000015263 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003643 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000015939 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000006101 | 1 retrocopy |
retro_etel_783 ,
|
Felis catus | ENSFCAG00000014090 | 1 retrocopy | |
Homo sapiens | ENSG00000100568 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000005620 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000004910 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000010843 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011184 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015866 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000007130 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000780 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000005927 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000006468 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000011671 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000003049 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007688 | 2 retrocopies |