RetrogeneDB ID: | retro_ggor_2693 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 8:134598062..134598362(+) | ||
Located in intron of: | ENSGGOG00000007362 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DPPA3 | ||
Ensembl ID: | ENSGGOG00000013040 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56. % |
Parental protein coverage: | 61.64 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | RRESVGAAVLREIEDEWLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKE--SRPF |
......A..L..I.D..LY.RRGV.TLLSVQ.E.MA.LRY.LL..V...ER..TN...KG...E..S.PF | |
Retrocopy | QQQHTRAMILK*IRDDLLYKRRGVKTLLSVQKERMAKLRYPLLSTVPRLERELTNTQLKGLQNE*RSEPF |
Parental | KCPCSFCVSNGWDPSENARIGNQDTKPLQP |
.C.CSFC..N..DPSENARIG..DTK.LQP | |
Retrocopy | QCCCSFCIFNR*DPSENARIGDYDTKSLQP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .52 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4010 |
Pan troglodytes | retro_ptro_2722 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046609 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000032092 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005409 | 10 retrocopies | |
Homo sapiens | ENSG00000187569 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000013040 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000017530 | 3 retrocopies | |
Mus musculus | ENSMUSG00000046323 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026887 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000024813 | 7 retrocopies | |
Pongo abelii | ENSPPYG00000004230 | 6 retrocopies | |
Pan troglodytes | ENSPTRG00000004617 | 7 retrocopies | |
Rattus norvegicus | ENSRNOG00000022950 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000000751 | 3 retrocopies |