RetrogeneDB ID: | retro_cjac_1465 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 16:34989168..34989437(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DPPA3 | ||
| Ensembl ID: | ENSCJAG00000005409 | ||
| Aliases: | None | ||
| Description: | developmental pluripotency associated 3 [Source:HGNC Symbol;Acc:19199] |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 55.9 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | REIGDDLPYRRRGVRTLLSVKRE-RLARLRYMLLGRGPRPERPLMNTGLKGVKNASRRGMFKCPCSFCKS |
| R.I.DDL.YR..GVR.LLS...E.R.ARLRY.LLGR.PR.ER.L.N.G.K.V.N......F....S.C.. | |
| Retrocopy | RKIRDDLLYRGKGVRMLLSIQKE<RMARLRYLLLGRVPRLERELTNVGHKVVQNETGSA*FRWCFSVCMY |
| Parental | SGWDPSENARMGNYDTKPLQP |
| ..WD.SEN.R.GNYDT.PLQP | |
| Retrocopy | NRWDLSENTRIGNYDTEPLQP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .00 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .00 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .00 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .00 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .00 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .02 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046609 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000032092 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005409 | 10 retrocopies |
retro_cjac_1329, retro_cjac_1446, retro_cjac_1465 , retro_cjac_1474, retro_cjac_2052, retro_cjac_2628, retro_cjac_3162, retro_cjac_4006, retro_cjac_622, retro_cjac_730,
|
| Homo sapiens | ENSG00000187569 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013040 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017530 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000046323 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026887 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000024813 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000004230 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000004617 | 7 retrocopies | |
| Rattus norvegicus | ENSRNOG00000022950 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000000751 | 3 retrocopies |