RetrogeneDB ID: | retro_ggor_271 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:102177807..102178208(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C1ORF123 | ||
Ensembl ID: | ENSGGOG00000004027 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.85 % |
Parental protein coverage: | 84.38 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | RWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARE-NSIEILSSTIKPYNAEDNENF |
.WYLKMKCGN..EIS.KW.YI.LMDSVALK.G.GS..MVQKCKLC..E.NS..ILS..IK.YNA.D.E.F | |
Retrocopy | QWYLKMKCGNGSEISEKWHYIQLMDSVALKWGHGSSFMVQKCKLCTQE<NSTVILSGSIKSYNAKDREKF |
Parental | KTIVEFECRGLEPVDFQPQAGFAAEGVESGTAFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC |
KTI.EFEC.G..P.DFQP.AGF.AEG..S.T.F.DI.LQEKDWTDYD.K..ESVGI.EV..QF.KC | |
Retrocopy | KTIIEFECQGFKPFDFQP*AGFSAEGTKSKTVFGDI-LQEKDWTDYDKKSRESVGISEVMQQFLKC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .69 RPM |
SRP007412_cerebellum | 0 .00 RPM | 34 .63 RPM |
SRP007412_heart | 0 .00 RPM | 10 .79 RPM |
SRP007412_kidney | 0 .00 RPM | 32 .96 RPM |
SRP007412_liver | 0 .00 RPM | 27 .80 RPM |
SRP007412_testis | 0 .00 RPM | 47 .97 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_192 |
Pongo abelii | retro_pabe_443 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy | |
Homo sapiens | ENSG00000162384 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy |
retro_ggor_271 ,
|
Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001336 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |