RetrogeneDB ID: | retro_pabe_443 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:129082318..129082719(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C1orf123 | ||
Ensembl ID: | ENSPPYG00000001336 | ||
Aliases: | None | ||
Description: | chromosome 1 open reading frame 123 [Source:HGNC Symbol;Acc:26059] |
Percent Identity: | 67.65 % |
Parental protein coverage: | 72.97 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | RWYLKMKCGNCGEISDKWQYIRLMDSMALKGGRGSASMVQKCKLCARE-NSIEILSSTIKPYNAEDNENF |
.WYLKMKCGN..EIS.KW.YI.LMDS.ALK.G.GS..MVQKCKLC..E.NS.E.....IK.YNA.D.E.F | |
Retrocopy | QWYLKMKCGNGSEISEKWHYIQLMDSVALKWGHGSSFMVQKCKLCTQE<NSTEVFNGSIKSYNAKDREKF |
Parental | KTIVEFECRGLEPVDFQPQAGFAAEGVESGTAFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC |
KTI.EFEC.G..P.DFQP.AGF.AEG..S.T.F.DI.LQEKDWTDYD.K..ESVGI.EV..QF.KC | |
Retrocopy | KTIIEFECQGFQPFDFQP*AGFSAEGTKSKTVFGDI-LQEKDWTDYDKKSRESVGISEVIQQFLKC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .58 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .32 RPM |
SRP007412_heart | 0 .12 RPM | 3 .79 RPM |
SRP007412_kidney | 0 .00 RPM | 5 .77 RPM |
SRP007412_liver | 0 .00 RPM | 5 .54 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_192 |
Gorilla gorilla | retro_ggor_271 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy | |
Homo sapiens | ENSG00000162384 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001336 | 1 retrocopy |
retro_pabe_443 ,
|
Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |