RetrogeneDB ID: | retro_rnor_2403 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 6:139916439..139916687(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RGD1559786 | ||
| Ensembl ID: | ENSRNOG00000012724 | ||
| Aliases: | None | ||
| Description: | UPF0587 protein C1orf123 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q498R7] |
| Percent Identity: | 58.33 % |
| Parental protein coverage: | 51.88 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | TLENVTNLRPVGEDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSIEILS |
| TLENV.NL.PVGEDF.WYL..KCG..G..SEK.Q...LMD..ALKG..G..SMVQK..L.A.E.S.E... | |
| Retrocopy | TLENVINLQPVGEDFQWYLEIKCGSYGKTSEK*Q*FQLMDGMALKGD*GRVSMVQKNMLRAWEKSTEMAN |
| Parental | STIKS-YNAEDNEK |
| ..IKS..N.E.N.K | |
| Retrocopy | NAIKS<LNIENNKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 24 .01 RPM |
| SRP017611_kidney | 0 .00 RPM | 17 .72 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .28 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_975 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy | |
| Homo sapiens | ENSG00000162384 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001336 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |
retro_rnor_1999, retro_rnor_2403 , retro_rnor_2705,
|