RetrogeneDB ID: | retro_rnor_2403 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 6:139916439..139916687(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RGD1559786 | ||
Ensembl ID: | ENSRNOG00000012724 | ||
Aliases: | None | ||
Description: | UPF0587 protein C1orf123 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q498R7] |
Percent Identity: | 58.33 % |
Parental protein coverage: | 51.88 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | TLENVTNLRPVGEDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSIEILS |
TLENV.NL.PVGEDF.WYL..KCG..G..SEK.Q...LMD..ALKG..G..SMVQK..L.A.E.S.E... | |
Retrocopy | TLENVINLQPVGEDFQWYLEIKCGSYGKTSEK*Q*FQLMDGMALKGD*GRVSMVQKNMLRAWEKSTEMAN |
Parental | STIKS-YNAEDNEK |
..IKS..N.E.N.K | |
Retrocopy | NAIKS<LNIENNKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 24 .01 RPM |
SRP017611_kidney | 0 .00 RPM | 17 .72 RPM |
SRP017611_liver | 0 .00 RPM | 9 .28 RPM |
Species | RetrogeneDB ID |
---|---|
Mus musculus | retro_mmus_975 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy | |
Homo sapiens | ENSG00000162384 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001336 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |
retro_rnor_1999, retro_rnor_2403 , retro_rnor_2705,
|