RetrogeneDB ID: | retro_mdom_744 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:302030640..302031057(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | YWHAE | ||
Ensembl ID: | ENSMODG00000010174 | ||
Aliases: | None | ||
Description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide [Source:HGNC Symbol;Acc:12851] |
Percent Identity: | 75.54 % |
Parental protein coverage: | 53.05 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | ESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEIL |
..KVFYYKMK.D..RYLAEF.TGND.K.A.EN.LV.YKA.SD..MTELPP.HPI.LGLA.NFSV.Y.EI. | |
Retrocopy | KGKVFYYKMKVDCLRYLAEFVTGNDLK*AIENTLVVYKASSDAVMTELPPVHPICLGLAHNFSVLY*EII |
Parental | NSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN |
.SPD.ACRLAKAAF.DAIAEL..L.EES..D.TL.MQLL.DNLTLWTSDMQGDG.EQNKE.LQD.EDEN | |
Retrocopy | ISPDHACRLAKAAFNDAIAELNALIEESDEDVTLMMQLLHDNLTLWTSDMQGDGKEQNKEVLQDMEDEN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000005664 | 3 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000010861 | 2 retrocopies | |
Ciona intestinalis | ENSCING00000023856 | 1 retrocopy | |
Ciona savignyi | ENSCSAVG00000011723 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000012056 | 2 retrocopies | |
Homo sapiens | ENSG00000108953 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000016840 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000006158 | 8 retrocopies | |
Monodelphis domestica | ENSMODG00000010174 | 2 retrocopies |
retro_mdom_1567, retro_mdom_744 ,
|
Monodelphis domestica | ENSMODG00000014740 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000016200 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000656 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000006155 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007769 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000008521 | 5 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000005084 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000010288 | 3 retrocopies |