RetrogeneDB ID: | retro_mluc_1303 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL429817:1886841..1887066(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS1B | ||
Ensembl ID: | ENSMLUG00000002408 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.33 % |
Parental protein coverage: | 79.79 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
M.HKQIYYSDKY.DE..EYRHVMLP....K.VPKTHLMSE.EWR.LGVQQS.GWVHYMIHEPEPHIL.FR | |
Retrocopy | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILFFR |
Parental | RPLPK |
.PLPK | |
Retrocopy | *PLPK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000033635 | 10 retrocopies | |
Cavia porcellus | ENSCPOG00000024061 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
Homo sapiens | ENSG00000173207 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013419 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000002408 | 1 retrocopy |
retro_mluc_1303 ,
|
Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000004796 | 1 retrocopy |