RetrogeneDB ID: | retro_mmul_941 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 12:22597768..22598143(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2372 | ||
| Ensembl ID: | ENSMMUG00000008029 | ||
| Aliases: | None | ||
| Description: | glutathione S-transferase mu 3 (brain) [Source:RefSeq peptide;Acc:NP_001248509] |
| Percent Identity: | 72.66 % |
| Parental protein coverage: | 56.89 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLMDGK |
| SC.SSMVLG.W.I.GLAH.I.LLL.F.DTSYEEK..TC...PD.D.SQWLDV.FKLDLDFPNLP..MDGK | |
| Retrocopy | SCNSSMVLG*WNICGLAHTICLLL*FMDTSYEEKWHTCQDTPDND*SQWLDVIFKLDLDFPNLPNFMDGK |
| Parental | NKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKP |
| NK.TQSNAIL.Y.A.KH.MCGET..EKI.VDI.EN....F.TQLI..CY.SDHEKLKP | |
| Retrocopy | NKVTQSNAILCYTAGKH-MCGET--EKIQVDISENEATNFHTQLIQHCYKSDHEKLKP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 45 .27 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 41 .57 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 79 .43 RPM |
| SRP007412_heart | 0 .00 RPM | 70 .60 RPM |
| SRP007412_kidney | 0 .23 RPM | 6 .10 RPM |
| SRP007412_liver | 0 .04 RPM | 1 .86 RPM |
| SRP007412_testis | 0 .08 RPM | 817 .04 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005380 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000003168 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000014211 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005817 | 2 retrocopies | |
| Homo sapiens | ENSG00000134202 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005185 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008029 | 2 retrocopies |
retro_mmul_610, retro_mmul_941 ,
|
| Macaca mulatta | ENSMMUG00000019630 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000001899 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000004032 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003302 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001063 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047034 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006821 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006736 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009682 | 1 retrocopy |