RetrogeneDB ID: | retro_mmus_411 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 1:9439770..9440202(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Pgam1 | ||
Ensembl ID: | ENSMUSG00000011752 | ||
Aliases: | Pgam1, 2310050F24Rik, Pgam-1 | ||
Description: | phosphoglycerate mutase 1 [Source:MGI Symbol;Acc:MGI:97552] |
Percent Identity: | 65.07 % |
Parental protein coverage: | 56.69 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 2 |
Parental | AKHGEAQVKI-WRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVP |
...GE.Q.KI..R.....P.P.MEP.HP..SNISKD.RY.D.TED.LPSC.SLKDTI..ALPFWNE...P | |
Retrocopy | SRNGEVQIKI<LR*LSNFPLPLMEPNHPLHSNISKDHRYVDFTED*LPSCMSLKDTISIALPFWNEDFAP |
Parental | QIKEG-KRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKA |
.IKEG.KRVLIA.H.NSL.GI.KHLE.LSEEAIMELN...G...VYELDKN..PI....FLGDE....KA | |
Retrocopy | *IKEG>KRVLIADHSNSLQGIAKHLESLSEEAIMELNP*PGNSTVYELDKNWPPIRWVWFLGDEDIKCKA |
Parental | MEAVAA |
M.AVAA | |
Retrocopy | MQAVAA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 34 .88 RPM |
SRP007412_cerebellum | 0 .00 RPM | 19 .84 RPM |
SRP007412_heart | 0 .00 RPM | 5 .88 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .92 RPM |
SRP007412_liver | 0 .00 RPM | 10 .13 RPM |
SRP007412_testis | 0 .00 RPM | 3 .52 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000012697 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009062 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016575 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000006844 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000005630 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000002467 | 1 retrocopy | |
Homo sapiens | ENSG00000171314 | 12 retrocopies | |
Gorilla gorilla | ENSGGOG00000028602 | 13 retrocopies | |
Macaca mulatta | ENSMMUG00000020027 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000004242 | 4 retrocopies | |
Mus musculus | ENSMUSG00000011752 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000002530 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000050585 | 7 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000018230 | 1 retrocopy | |
Drosophila melanogaster | FBgn0014869 | 1 retrocopy |