RetrogeneDB ID: | retro_ocun_1155 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 3:9971726..9971941(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOCUG00000022970 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.27 % |
Parental protein coverage: | 56.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | YQQRVEDVRLIREQHPTK-IPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFL |
.QQR..DV.LI.EQ.PTK..PV...R.KGEKQ.P.LDK.KFLVPDHVNMSELIK..RR.LQLNA.QA.FL | |
Retrocopy | FQQR-GDVQLIQEQYPTK<VPVVTGRNKGEKQPPTLDKSKFLVPDHVNMSELIKTNRRCLQLNARQAIFL |
Parental | LVNG |
.V.G | |
Retrocopy | FVKG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 48 .51 RPM |
SRP017611_kidney | 0 .00 RPM | 53 .72 RPM |
SRP017611_liver | 0 .00 RPM | 16 .96 RPM |