RetrogeneDB ID: | retro_ocun_362 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 1:51762722..51763056(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CSNK2B | ||
Ensembl ID: | ENSOCUG00000023483 | ||
Aliases: | CSNK2B, CK-II, CK2N, Phosvitin | ||
Description: | casein kinase 2, beta polypeptide (CSNK2B), mRNA [Source:RefSeq mRNA;Acc:NM_001160283] |
Percent Identity: | 56.9 % |
Parental protein coverage: | 53.02 % |
Number of stop codons detected: | 6 |
Number of frameshifts detected | 2 |
Parental | SEEVSWISWFCGLRGNEFFCEV-DEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLI |
SEE.S.IS.F.GL..NE.FC...D..YIQDK.NLT.LNE.VP...Q..D.IL..EPDE...DNPNQS.LI | |
Retrocopy | SEEMSQISRF*GLHRNELFCKM<DQEYIQDKCNLTRLNEHVPP**QVPDRILNPEPDEQQKDNPNQSNLI |
Parental | EQAAEMLYGLIHARYILT-NRGIAQMLEKYQQGDFGYCPRVYCENQ |
E...E..YGL......L....GI.QM.E..Q..DFG.CP.VYCENQ | |
Retrocopy | EK-DESFYGLADTLSLLS<HLGITQMSE*WQR-DFG*CP*VYCENQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 91 .23 RPM |
SRP017611_kidney | 0 .00 RPM | 96 .39 RPM |
SRP017611_liver | 0 .00 RPM | 37 .07 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000005751 | 1 retrocopy | |
Bos taurus | ENSBTAG00000008837 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000002996 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000018728 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000014179 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000006417 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000015168 | 3 retrocopies | |
Felis catus | ENSFCAG00000007642 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000004095 | 10 retrocopies | |
Monodelphis domestica | ENSMODG00000015287 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000011129 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000023483 | 2 retrocopies |
retro_ocun_1477, retro_ocun_362 ,
|
Ochotona princeps | ENSOPRG00000012138 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000001478 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000001414 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014103 | 2 retrocopies |