RetrogeneDB ID: | retro_ogar_3275 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873763.1:408740..408923(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CSTB | ||
| Ensembl ID: | ENSOGAG00000006101 | ||
| Aliases: | None | ||
| Description: | cystatin B (stefin B) [Source:HGNC Symbol;Acc:2482] |
| Percent Identity: | 58.73 % |
| Parental protein coverage: | 64.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | PATAKTQDIADQVKSQLEEKENKKFPVFKAVSFKSQVVAGTNFFIKVHVGDEKFVHLRVFQSL |
| P.......I..Q.KS.LE.KE.KKF.VFKA.SFKSQVVAG.N.FIKVH.GD....HL....SL | |
| Retrocopy | PSPCRPHGITNQAKSKLELKE-KKFSVFKANSFKSQVVAGIN-FIKVHAGDQNIIHLHFGVSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000000524 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002664 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000022457 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012303 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006101 | 2 retrocopies |
retro_ogar_3274, retro_ogar_3275 ,
|
| Pteropus vampyrus | ENSPVAG00000007022 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000001201 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017952 | 3 retrocopies |