RetrogeneDB ID: | retro_pabe_432 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:115401056..115401286(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTS | ||
Ensembl ID: | ENSPPYG00000003880 | ||
Aliases: | None | ||
Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
Percent Identity: | 55.13 % |
Parental protein coverage: | 67.26 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | GGRRCQAQVSRRISFSA-SHRL-YSKFLSDEENLKLFGKCSNPNGHGHNYKVVVTVHGEIDPATGMVMNL |
G.R..Q..V....SFS..SHRL..SK.LS..E..K.F..C.N.N.H.H.YKVV..V.G.IDP.TGMVMN. | |
Retrocopy | GARSHQVLVYSLHSFST>SHRL>HSKSLSIKETIKQF*NCNNANVHEHDYKVVFIVYGGIDPVTGMVMNM |
Parental | ADLKKYME |
..L.KYME | |
Retrocopy | INLIKYME |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 2 .71 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .46 RPM |
SRP007412_heart | 0 .00 RPM | 1 .23 RPM |
SRP007412_kidney | 0 .00 RPM | 3 .25 RPM |
SRP007412_liver | 0 .03 RPM | 7 .56 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_337 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000013 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000012437 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
Homo sapiens | ENSG00000150787 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007299 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000017191 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000003880 | 1 retrocopy |
retro_pabe_432 ,
|
Pan troglodytes | ENSPTRG00000004288 | 3 retrocopies |