RetrogeneDB ID: | retro_ptro_2979 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | GL390127.1:11437..11681(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTS | ||
| Ensembl ID: | ENSPTRG00000004288 | ||
| Aliases: | None | ||
| Description: | 6-pyruvoyl tetrahydrobiopterin synthase [Source:UniProtKB/TrEMBL;Acc:H2R4Y8] |
| Percent Identity: | 55.81 % |
| Parental protein coverage: | 57.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | EIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIW-DNLQKVLPV-GVLYK |
| .IDP.TGMV.NL..L..Y..EAI..PLD...LD.D..Y.......TENVAV......L.K.LPV.GVLYK | |
| Retrocopy | KIDPVTGMVSNLTNLMAYIGEAIVKPLD--SLDLDMLYCDNGLCVTENVAVSTG<ERLGKFLPV<GVLYK |
| Parental | VKVYETDNNIVVYKGE |
| .KV.ET..NIVVYKG. | |
| Retrocopy | AKVHETVSNIVVYKGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .30 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .03 RPM |
| SRP007412_kidney | 0 .00 RPM | 6 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .89 RPM |
| SRP007412_testis | 0 .00 RPM | 2 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000013 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012437 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
| Homo sapiens | ENSG00000150787 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007299 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000017191 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000003880 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004288 | 3 retrocopies |
retro_ptro_2315, retro_ptro_2979 , retro_ptro_337,
|