RetrogeneDB ID: | retro_ogar_609 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873524.1:43387731..43387954(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTS | ||
| Ensembl ID: | ENSOGAG00000017191 | ||
| Aliases: | None | ||
| Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 51.72 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | ARVSRCTTFSASHRLYSKHLDDDENLKLFGKCSNPNGHGHNYKVVVTV-HGEIDPVTGMVMNLTDLKKY- |
| A.VS.C..FS.SH.LYS..LDD.EN.KLFGKCSNPN.HG.NYKVV..V..GEI.PV.GM.MNLTDLKK.. | |
| Retrocopy | AQVSCCIYFSVSHWLYS*NLDDEENIKLFGKCSNPNSHGYNYKVVLPV<RGEIGPVAGMIMNLTDLKKI< |
| Parental | MEEAIMK |
| MEEAI.K | |
| Retrocopy | MEEAILK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000013 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012437 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
| Homo sapiens | ENSG00000150787 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007299 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000017191 | 3 retrocopies |
retro_ogar_1718, retro_ogar_2790, retro_ogar_609 ,
|
| Pongo abelii | ENSPPYG00000003880 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004288 | 3 retrocopies |