RetrogeneDB ID: | retro_psin_31 | ||
Retrocopylocation | Organism: | Chinese softshell turtle (Pelodiscus sinensis) | |
Coordinates: | JH206105.1:1439630..1439873(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPF | ||
Ensembl ID: | ENSPSIG00000016462 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
Percent Identity: | 77.78 % |
Parental protein coverage: | 94.19 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYI |
L.LNPK.FLNGLTGKPVM.KLK..M.YKGYLVSV.G..NMQLANTEEYI..AL.GHLGEVLIRCNN.LYI | |
Retrocopy | LALNPKLFLNGLTGKPVMGKLK*RMKYKGYLVSVNGNLNMQLANTEEYINSALFGHLGEVLIRCNNALYI |
Parental | RGVEEEEEDGE |
RGV.EE....E | |
Retrocopy | RGVVEEDGGNE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000006395 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000013509 | 4 retrocopies | |
Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000017426 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000016462 | 2 retrocopies |
retro_psin_31 , retro_psin_54,
|
Sarcophilus harrisii | ENSSHAG00000012294 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000006837 | 4 retrocopies |