RetrogeneDB ID: | retro_cfam_742 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 16:51596285..51596513(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPF | ||
Ensembl ID: | ENSCAFG00000006395 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
Percent Identity: | 57.14 % |
Parental protein coverage: | 69.37 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | PFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEE |
P.L.......V....KWGME..G.L.....Y.N.QLA....Y.DGALSGHL..VL.R.NNVLYIRG..EE | |
Retrocopy | PNLSSIS*QEVAGTFKWGMESTGHLGTSGSYRNTQLASIYGYTDGALSGHLSGVLVRRNNVLYIRGT-EE |
Parental | EEDGEMR |
EEDGEMR | |
Retrocopy | EEDGEMR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 10 .96 RPM |
SRP017611_brain | 0 .00 RPM | 3 .97 RPM |
SRP017611_kidney | 0 .00 RPM | 14 .66 RPM |
SRP017611_liver | 0 .00 RPM | 2 .54 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000006395 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000013509 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000001558 | 3 retrocopies | |
Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
Latimeria chalumnae | ENSLACG00000002456 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000017426 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000008091 | 3 retrocopies | |
Pelodiscus sinensis | ENSPSIG00000016462 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000012294 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000006837 | 4 retrocopies |