RetrogeneDB ID: | retro_rnor_995 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 14:12071220..12071633(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Prelid1 | ||
Ensembl ID: | ENSRNOG00000016410 | ||
Aliases: | Prelid1, Preli, RGD1308082 | ||
Description: | PRELI domain-containing protein 1, mitochondrial [Source:RefSeq peptide;Acc:NP_001009636] |
Percent Identity: | 63.31 % |
Parental protein coverage: | 63.59 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | YILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGL |
.ILEDSI.DPQ.QTMT.F.WN.NH..L.VVE..C.YCVNS..S.WTE.........SLF.V.R...EFG. | |
Retrocopy | HILEDSIEDPQTQTMTSFIWNTNHTPLVVVEKQCTYCVNSNDSYWTEVPWQTGSLVSLFDVTRGADEFGF |
Parental | ARFKSNVTKTMKGFEYILAKLQGEAPSKTL-VETAKEAKEKAKETALAATEKAKDLANKAATKQQQQQL |
..F.SNVTKTMK.FEYILAKL..EAPSKTL.VET..EAKE.AKET.LAATEK.KDL...A.T..Q.Q.. | |
Retrocopy | GCFRSNVTKTMKVFEYILAKLHEEAPSKTL<VETSTEAKETAKETVLAATEKGKDLTHEATTT*QPQKI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 76 .28 RPM |
SRP017611_kidney | 0 .00 RPM | 141 .10 RPM |
SRP017611_liver | 0 .00 RPM | 87 .48 RPM |
Species | RetrogeneDB ID |
---|---|
Mus musculus | retro_mmus_2672 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000002251 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000006953 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000025788 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017550 | 1 retrocopy | |
Equus caballus | ENSECAG00000023460 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011762 | 3 retrocopies | |
Macropus eugenii | ENSMEUG00000001738 | 12 retrocopies | |
Myotis lucifugus | ENSMLUG00000007008 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000009046 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000004804 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021486 | 7 retrocopies | |
Otolemur garnettii | ENSOGAG00000011455 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000016410 | 8 retrocopies |
retro_rnor_1138, retro_rnor_1166, retro_rnor_1243, retro_rnor_1906, retro_rnor_2178, retro_rnor_2305, retro_rnor_637, retro_rnor_995 ,
|