RetrogeneDB ID: | retro_shar_584 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
Coordinates: | GL850523.1:146..377(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | VAMP4 | ||
Ensembl ID: | ENSSHAG00000017179 | ||
Aliases: | None | ||
Description: | vesicle-associated membrane protein 4 [Source:HGNC Symbol;Acc:12645] |
Percent Identity: | 50.63 % |
Parental protein coverage: | 53.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | KFKRHLN-DDDVTGS-VKSERRNLLEEDSDEEED-FFLRGPSGPKFGPRNDKIRHVQNQVDEVIDVMQEN |
KFK..LN.D...T....KSE.R.LL.E.....ED.F...GP.G......NDKIRH.Q...D..I..MQEN | |
Retrocopy | KFKNLLNDDNYITDL<MKSEKRKLLKEYLNGKED>FSPKGPNGSNIWSKNDKIRHLQDWIDKAIYSMQEN |
Parental | ITKVIERGE |
ITKVI.RG. | |
Retrocopy | ITKVIKRGD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016956 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000124 | 4 retrocopies | |
Felis catus | ENSFCAG00000013371 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000011226 | 13 retrocopies | |
Monodelphis domestica | ENSMODG00000003811 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000015609 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015967 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000026745 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000014342 | 1 retrocopy | |
Sorex araneus | ENSSARG00000001709 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000017179 | 2 retrocopies |
retro_shar_584 , retro_shar_747,
|
Tupaia belangeri | ENSTBEG00000010829 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007424 | 1 retrocopy |