RetrogeneDB ID: | retro_sscr_821 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 5:58029463..58029843(-) | ||
| Located in intron of: | ENSSSCG00000000591 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PGAM5 | ||
| Ensembl ID: | ENSSSCG00000026764 | ||
| Aliases: | None | ||
| Description: | phosphoglycerate mutase family member 5 [Source:HGNC Symbol;Acc:28763] |
| Percent Identity: | 50.77 % |
| Parental protein coverage: | 53.91 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | REPLSEPGEEELAS-RLDHY-KAKA-TRHIFLIRHSQYHVDASLEKDRTLTPLGREQAELTGL-RLASLG |
| .E.L...GE....S.R.DHY.K....T.HI..I..SQY..DASLEK.R.L.PL.RE..ELTG.....SLG | |
| Retrocopy | KEILQSGGEKPRRS<RQDHY>KSRSRTWHISRISYSQYQADASLEKNRALMPLSREPEELTGN*PTVSLG |
| Parental | LKF-NKIVHSSMTRAIETTDIISKHLPGVCRVSTDLLREGAP-IEPDPPVWAGSPSAVQY |
| ..F.NKI.H.S.TRAIE.....S.HL.GV...STDLL.E.AP....DP...A....A.QY | |
| Retrocopy | RNF>NKILHCSETRAIEKSYSNSQHLQGVSKFSTDLLGESAP>LQADPQGSALEAAALQY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 24 .69 RPM |
| SRP014902_testis | 0 .00 RPM | 28 .57 RPM |
| SRP018288_heart | 0 .00 RPM | 17 .34 RPM |
| SRP018288_kidney | 0 .00 RPM | 15 .27 RPM |
| SRP018288_liver | 0 .00 RPM | 6 .24 RPM |
| SRP018288_lung | 0 .00 RPM | 20 .26 RPM |
| SRP018856_adipose | 0 .00 RPM | 17 .68 RPM |
| SRP035408_brain | 0 .00 RPM | 9 .69 RPM |
| SRP035408_liver | 0 .00 RPM | 6 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013437 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000011867 | 2 retrocopies | |
| Felis catus | ENSFCAG00000002503 | 2 retrocopies | |
| Homo sapiens | ENSG00000247077 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000013646 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015466 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002639 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005657 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000037443 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000026764 | 1 retrocopy |
retro_sscr_821 ,
|
| Tursiops truncatus | ENSTTRG00000010653 | 1 retrocopy |