RetrogeneDB ID: | retro_tbel_3190 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_133528:2700..2985(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PAM16 | ||
Ensembl ID: | ENSTBEG00000001347 | ||
Aliases: | None | ||
Description: | presequence translocase-associated motor 16 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:29679] |
Percent Identity: | 88.42 % |
Parental protein coverage: | 97.94 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAANARGRAGHQSAAASSLSGLSLQEAQQILNVSKLSP |
.AKYLAQIIVM.VQVVGRAFA.AL.QEFAASRAA..ARGRAGHQSAAASSLSGLSLQEAQQILN.SKLSP | |
Retrocopy | LAKYLAQIIVMRVQVVGRAFAQALWQEFAASRAASDARGRAGHQSAAASSLSGLSLQEAQQILNISKLSP |
Parental | EEIQKNYEHLFKVNDKSVGGSFYLQ |
.E.QKNYEHLFK.NDKSVG.SFYLQ | |
Retrocopy | KEVQKNYEHLFKMNDKSVGSSFYLQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009200 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000019226 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies | |
Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
Felis catus | ENSFCAG00000027971 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies | |
Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy |
retro_tbel_3190 ,
|
Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |