RetrogeneDB ID: | retro_eeur_213 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_210772:5..221(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSEEUG00000003685 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PAM16 | ||
Ensembl ID: | ENSEEUG00000007432 | ||
Aliases: | None | ||
Description: | presequence translocase-associated motor 16 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:29679] |
Percent Identity: | 71.62 % |
Parental protein coverage: | 58.54 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | TGLSLQEAQQILNV-SKLNPEEIQKNYQHLFKVNDKSVGGSFYLQSKVVRA-KERLDEELRIRAQEDRGK |
TGLSL.EAQQI..V.SK.N..EIQKNY.HLFKV..KSV..SF.LQSKVV...KE.LD.EL.I.AQEDRGK | |
Retrocopy | TGLSLWEAQQIPMV>SKINAKEIQKNYEHLFKVDNKSVDSSFHLQSKVVPI<KECLDRELGIQAQEDRGK |
Parental | EPQT |
EP.T | |
Retrocopy | EPKT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .16 RPM | 11 .44 RPM |
SRP017611_kidney | 0 .00 RPM | 25 .69 RPM |
SRP017611_liver | 0 .00 RPM | 16 .88 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009200 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000019226 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies |
retro_eeur_138, retro_eeur_171, retro_eeur_213 , retro_eeur_234, retro_eeur_273, retro_eeur_440, retro_eeur_673,
|
Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
Felis catus | ENSFCAG00000027971 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies | |
Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |