RetrogeneDB ID: | retro_eeur_213 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_210772:5..221(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSEEUG00000003685 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PAM16 | ||
| Ensembl ID: | ENSEEUG00000007432 | ||
| Aliases: | None | ||
| Description: | presequence translocase-associated motor 16 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:29679] |
| Percent Identity: | 71.62 % |
| Parental protein coverage: | 58.54 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | TGLSLQEAQQILNV-SKLNPEEIQKNYQHLFKVNDKSVGGSFYLQSKVVRA-KERLDEELRIRAQEDRGK |
| TGLSL.EAQQI..V.SK.N..EIQKNY.HLFKV..KSV..SF.LQSKVV...KE.LD.EL.I.AQEDRGK | |
| Retrocopy | TGLSLWEAQQIPMV>SKINAKEIQKNYEHLFKVDNKSVDSSFHLQSKVVPI<KECLDRELGIQAQEDRGK |
| Parental | EPQT |
| EP.T | |
| Retrocopy | EPKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .16 RPM | 11 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 25 .69 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .88 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009200 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019226 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies |
retro_eeur_138, retro_eeur_171, retro_eeur_213 , retro_eeur_234, retro_eeur_273, retro_eeur_440, retro_eeur_673,
|
| Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027971 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |