RetrogeneDB ID: | retro_cjac_1999 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 20:31123686..31124053(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TPRKB | ||
Ensembl ID: | ENSCJAG00000004162 | ||
Aliases: | None | ||
Description: | TP53RK binding protein [Source:HGNC Symbol;Acc:24259] |
Percent Identity: | 51.59 % |
Parental protein coverage: | 78.98 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | QLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVA-ANKAVHLYKLGKM |
QLT.QLD.FP.CRVT.LLF.D.K.A.DLRRK.......GSLIN..V..D.FQIL.A..NKAV..YK.GK. | |
Retrocopy | QLTYQLDIFPKCRVTILLFEDTKSAEDLRRKVTKVIFSGSLINAVVTIDLFQILLA<INKAVYFYKVGKI |
Parental | KTR-TLSTEIIYNLSPNNNISEALKKFGISGNDTSILIVYIEEGEKQINQEYLISQ |
KTR.TL.TEII.N.SP.N.I.E..K..G.S..............EK.....YL... | |
Retrocopy | KTR<TLGTEIIRNVSPTNIILET*KEIGLSKRHFNFIFFTLKR-EKKSRTFYLLTR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 5 .99 RPM |
SRP051959_heart | 0 .00 RPM | 6 .51 RPM |
SRP051959_kidney | 0 .00 RPM | 4 .88 RPM |
SRP051959_liver | 0 .00 RPM | 5 .96 RPM |
SRP051959_lung | 0 .00 RPM | 3 .38 RPM |
SRP051959_lymph_node | 0 .00 RPM | 4 .91 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 10 .02 RPM |
SRP051959_spleen | 0 .00 RPM | 4 .03 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012021 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004162 | 3 retrocopies |
retro_cjac_1999 , retro_cjac_2867, retro_cjac_3065,
|
Homo sapiens | ENSG00000144034 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009062 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000030805 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000016950 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000300 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016251 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000032893 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000012292 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000012419 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000016406 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000014584 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007934 | 2 retrocopies |