RetrogeneDB ID: | retro_mmul_1571 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 20:75295606..75295976(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TPRKB | ||
| Ensembl ID: | ENSMMUG00000030805 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.69 % |
| Parental protein coverage: | 71.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVA-ANKAVHLYKLGK |
| M.LTHQLD.FP.C.V..LLF.D.K.A.DLR.K..E....GSLIN..V..D.FQILVA..NKAVHLYK.GK | |
| Retrocopy | MPLTHQLDVFPKCGVIILLFEDIKSAEDLR*KVTEVIFNGSLINAMVTIDLFQILVA<INKAVHLYKVGK |
| Parental | MKTRTLSTEIIFNLSPNNNISEALKKF-GISANDTSILIVYIEEGEKQINQEYLISQ |
| .KTR.L..EII.N.SPNN.I.EALKK....S.N.T.ILI......E......Y..S. | |
| Retrocopy | IKTRILCMEIIPNVSPNNIILEALKKI<YVSINGTLILI-FLQ*KERRNQELYMLSR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 5 .27 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .62 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .52 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .12 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .39 RPM |
| SRP007412_testis | 0 .00 RPM | 9 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012021 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004162 | 3 retrocopies | |
| Homo sapiens | ENSG00000144034 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009062 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000030805 | 1 retrocopy |
retro_mmul_1571 ,
|
| Monodelphis domestica | ENSMODG00000016950 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000300 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016251 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000032893 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000012292 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000012419 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000016406 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000014584 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007934 | 2 retrocopies |