RetrogeneDB ID: | retro_mdom_1264 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 4:162776192..162776610(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TPRKB | ||
Ensembl ID: | ENSMODG00000016950 | ||
Aliases: | None | ||
Description: | TP53RK binding protein [Source:HGNC Symbol;Acc:24259] |
Percent Identity: | 78.17 % |
Parental protein coverage: | 80.57 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MQLTYQLDLFPECTVTLLLFCDVKNAGELRKKAMEGSINGALINATMVVDPFQLLVAANKAVHLHKLGKM |
MQL.Y.LD.FPECT.TLLLF.D.KN.G.LRKKAM.GSING.LINATMVVDPFQLLVAANK.VH..K.GK. | |
Retrocopy | MQLSY*LDRFPECTLTLLLFYDIKNTGDLRKKAMKGSINGTLINATMVVDPFQLLVAANKSVHFYKPGKI |
Parental | KTRTLCTEIIFNLSPNNSISEALKKFGI-SDNDTSILIVCVEEGEKRMNPEDLVSQVDGRQVSFDKLPEI |
KTRTLCTEIIFNLSPNNSISEALKKFGI..D....I..V...EGEK.MNPEDL.SQ.D..QVSFDKLPEI | |
Retrocopy | KTRTLCTEIIFNLSPNNSISEALKKFGI>DDTSVLIVYV--KEGEK*MNPEDLISQMDSHQVSFDKLPEI |
Parental | TD |
TD | |
Retrocopy | TD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012021 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004162 | 3 retrocopies | |
Homo sapiens | ENSG00000144034 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009062 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000030805 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000016950 | 2 retrocopies |
retro_mdom_1264 , retro_mdom_465,
|
Nomascus leucogenys | ENSNLEG00000000300 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016251 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000032893 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000012292 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000012419 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000016406 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000014584 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007934 | 2 retrocopies |